Lab-tested peptides Free EU shipping over €250 Secure payments via Stripe

Cagrilintide 5mg

74,00 

Cagrilintide is a long-acting analogue of amylin, a natural peptide released together with insulin. It is being studied for its potential role in appetite regulation, weight reduction, and improvement of insulin sensitivity.

Preclinical studies have shown promising results in the fields of obesity and type 2 diabetes, as well as interesting prospects in areas such as liver damage, cardiovascular diseases, and metabolic health. Recent research has highlighted a synergistic effect when combined with semaglutide, resulting in more pronounced and longer-lasting weight loss.

Perdita Peso

Availability: In stock

Solvent not included. Add Bacteriostatic Water.
Verified quality and secure purchase
  • Independent COA for every batch
  • Ships within 24h from EU stock — tracked
  • Secure payments — Stripe protected
  • 14-Day Money Back Guarantee
Each batch is verified with COA.
Independent laboratory analysis available

Report linked to the currently available batch.

Latest tested batchPC-CG5-1512B
Purity99.943%
Quantity5.07mg
Open batch certificate →
Pay With

Cagrilintide – Amylin Analogue for Research on Obesity, Metabolism, and Glycemic Control

Cagrilintide is a long-acting synthetic analogue of amylin, a natural peptide secreted by pancreatic beta cells together with insulin. It is being studied for its potential in the experimental treatment of obesity, type 2 diabetes, and other metabolic disorders. Thanks to its resistance to enzymatic degradation, it has an extended half-life that provides more stable and long-lasting effects compared to natural amylin.

In animal models, Cagrilintide has shown a significant reduction in appetite, improved glycemic control, and sustained weight loss. It has been investigated not only for its effects on carbohydrate metabolism but also for its potential impact on liver injury, cardiovascular health, and neuronal protection. Some studies have observed a synergistic effect when combined with Semaglutide, with superior results in body weight reduction and body composition improvement.


Origin and Function of Amylin

Amylin (also known as IAPP – Islet Amyloid Polypeptide) is a peptide co-secreted with insulin by pancreatic beta cells. It acts as a regulator of energy metabolism by inducing satiety, slowing gastric emptying, and contributing to the stabilization of postprandial glucose levels. This regulatory mechanism helps prevent sharp fluctuations in blood glucose, promoting a more efficient use of sugars as an energy source and reducing their conversion into fat.

Amylin also plays a role in bone metabolism, sharing structural and functional similarities with calcitonin and the calcitonin gene-related peptide (CGRP). These peptides help reduce calcium levels in the blood by promoting its deposition in bones. However, endogenous amylin is rapidly degraded by the same enzymes that inactivate insulin, limiting its therapeutic effectiveness. Cagrilintide was designed to overcome this limitation, offering greater plasma stability and a prolonged duration of action.


Mechanism of Action of Cagrilintide

Cagrilintide acts through several physiological mechanisms involving the gastrointestinal tract, the central nervous system, and the pancreas. In the stomach, it slows food transit, prolonging digestion and promoting a sense of fullness. This process reduces overall caloric intake and limits postprandial glucose spikes. Additionally, its action on the central nervous system – particularly on the arcuate nucleus of the hypothalamus – stimulates satiety signals and modulates feeding behavior.

In the pancreas, Cagrilintide helps reduce glucagon secretion, a hormone that stimulates glucose production by the liver. This synergistic mechanism, similar to that observed with GLP-1 agonists, improves the balance between insulin and glucagon, reducing the body’s tendency to convert glucose into fat. The result is an improvement in the glycemic profile and a gradual reduction in fat mass.


Structure and Peptide Design

Cagrilintide represents an advanced example of peptide engineering. Its sequence has been modified to resist enzymatic degradation and to prevent the protein aggregation typical of natural amylin. The addition of proline residues in the terminal region reduces amyloid fibril formation, while the presence of a lipid chain at the N-terminal end enhances brain penetration and binding to amylin receptors (RAMP-1 and RAMP-3). These modifications give the peptide a prolonged half-life and a more favorable pharmacodynamic profile compared to its predecessors, such as pramlintide.


Research on Obesity and Metabolism

In experimental studies, weekly administration of Cagrilintide produced a 6–11% reduction in body weight within a few weeks compared to placebo. When combined with Semaglutide, the results were even more remarkable, with reductions of up to 17% of total body mass. This synergistic effect suggests a functional interaction between amylin and GLP-1 receptors, leading to a more effective suppression of appetite and improved insulin sensitivity.

Beyond its effects on weight loss, research has shown improvements in metabolic parameters such as fasting glucose, insulin levels, and glycated hemoglobin (HbA1c). These findings make Cagrilintide a promising candidate for metabolic and nutraceutical research, especially for studies on energy regulation and carbohydrate metabolism.


Cagrilintide and Cognitive Health

Interest in Cagrilintide extends beyond metabolism. Natural amylin has been associated with brain functions related to memory and cognitive regulation. Some studies have suggested a link between abnormal amylin levels and the formation of amyloid plaques in the brain, similar to those observed in Alzheimer’s disease. Although there is no conclusive data on the direct role of Cagrilintide in this area, its resistance to aggregation could theoretically contribute to neuroprotection and a reduction in oxidative stress in brain tissue.

The relationship between glycemic control and cognitive function is a growing focus in scientific research. Chronic hyperglycemia is known to increase inflammatory and oxidative processes that damage neuronal cells. By improving blood sugar regulation and insulin response, Cagrilintide could indirectly support better brain health and long-term cognitive function.


Synthesis and Research Applications

Cagrilintide is produced via solid-phase peptide synthesis (SPPS), ensuring high purity and stability. It is supplied as a lyophilized powder for research use only and can be reconstituted in aqueous solution or diluted acetic acid. Stable for up to 24 months at −20°C, it is suitable for long-term laboratory studies. Its use is restricted to scientific and cosmetic research contexts aimed at exploring metabolic regulation, hormonal signaling, and peptide interactions in weight and appetite control.

Note: The information provided is intended solely for descriptive and research purposes. Cagrilintide is not intended for human or veterinary use and must not be applied for therapeutic purposes. All handling should take place exclusively in controlled laboratory environments compliant with research regulations.


Scientific References

Peptide Technical Data

CAS Number 1415456-99-3
PubChem SID 171397054
Synonyms AT42613, AM833[1]
Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula C194H312N54O59S2·xC2H4O2
Molecular Weight 4409.01 g/mol
Purity ≥99%
Applications Obesity research, appetite regulation studies, type 2 diabetes research, metabolic health investigations
Synthesis Solid-phase synthesis
Solubility Soluble in water or 1% acetic acid
Stability & Storage Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months.
Appearance White lyophilized powder
Shipping Conditions Shipped at ambient temperature; once received, store at -20°C
Regulatory/Compliance Manufactured in a facility that adheres to cGMP guidelines

Disclaimer - For Research Use Only

The products offered by Pepticore Aminos are intended exclusively for research and laboratory use and are sold only to qualified professionals, institutions, or authorized entities. These products are not intended for human or veterinary consumption, nor for any application involving living organisms, including – but not limited to – diagnostic, therapeutic, or recreational purposes.

By making a purchase, the customer declares that:

  • they are a qualified professional or entity, possessing the necessary competence, training, and facilities for the safe handling of chemical reagents;
  • they will use the product in full compliance with all applicable local, national, and European Union laws and regulations;
  • they will adopt appropriate safety measures during all stages of handling, storage, and disposal.

Prohibited uses:

  • The product must not be used as an Active Pharmaceutical Ingredient (API) in the manufacturing or preparation of medicines intended for humans or animals;
  • Any direct administration or use on humans or animals is strictly prohibited;
  • Pepticore Aminos does not endorse or permit the use of its products for the production, testing, or development of illegal substances.

Regulatory compliance:

Pepticore Aminos does not claim or imply that its products are approved by the European Medicines Agency (EMA), the Food and Drug Administration (FDA), or any other regulatory authority. All information provided is for informational and scientific purposes only. These products are not intended to diagnose, treat, cure, or prevent any disease.

Liability:

L’acquirente si assume ogni responsabilità per la manipolazione, conservazione e utilizzo del prodotto in condizioni sicure e conformi alla legge.
Pepticore Aminos non potrà essere ritenuta responsabile per danni diretti o indiretti derivanti da un uso improprio, dallo stoccaggio non corretto o da un utilizzo non autorizzato del prodotto.
Pepticore Aminos si riserva il diritto di rifiutare la vendita a qualsiasi individuo o ente sospettato di uso improprio dei propri prodotti.

In case of doubts regarding the safe and lawful use of the product, it is recommended to consult a qualified professional experienced in laboratory research.

Storage

Storage Instructions

All Pepticore Aminos products are manufactured using a lyophilization (freeze-drying) process, which ensures product stability during shipping for up to 3–4 months.

Once reconstituted (mixed with bacteriostatic water), the peptides should be stored in the refrigerator to maintain stability. After reconstitution, they remain stable for up to 30 days.

What is Lyophilization

Lyophilization is a dehydration process, also known as cryodesiccation, in which peptides are first frozen and then exposed to low pressure. Under these conditions, the water in the vial sublimates directly from solid to gas, leaving behind a stable, white crystalline structure (lyophilized peptide).

The white powder can be stored at room temperature until reconstitution with bacteriostatic water.

Storage After Delivery

Keep peptides cool and protected from light. For use within a few days, weeks, or months, simple refrigeration at a temperature of < 4 °C (39 °F) is sufficient.

Lyophilized peptides are generally stable at room temperature for several weeks or longer; if use is expected within a few weeks or months, this storage condition is acceptable.

Long-Term Storage

For periods of several months or years, storage in a −80 °C (−112 °F) freezer is recommended as the optimal solution to preserve peptide stability.

For more information on proper storage techniques, visit:
Peptide Storage Information

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Shopping Cart

Access Your Welcome Code

WELCOME10

Research Access Code — 10%
Applicable to eligible individual products only.

Access 10% Welcome Code
cagrilintide 5mg peptide italia acquisto fialaCagrilintide 5mg
74,00 

Availability: In stock

Verified quality and secure purchase
  • Independent COA for every batch
  • Ships within 24h from EU stock — tracked
  • Secure payments — Stripe protected
  • 14-Day Money Back Guarantee
Each batch is verified with COA.
Independent laboratory analysis available

Report linked to the currently available batch.

Latest tested batchPC-CG5-1512B
Purity99.943%
Quantity5.07mg
Open batch certificate →